McDonnell Genome Institute

Washington University

Transcript

lnc-RNF126-2:1

Chromosome

chr19

Gene Name

lnc-RNF126-2

Start

673880

CPC Label

noncoding

End

674651

Cancer

OV

Strand

-

Peptide

DWGVGQGWDPVFSLR

Modified Peptide

n[145]DWGVGQGWDPVFSLR

Peptide Length

15

ORF Length

35

Open Reading Frame (ORF)

LALASGIPPGLSRDWGVGQGWDPVFSLRMCGGWTV

Conservation Score

0.895

PhyloCSF Frame 1

-3.355

No. of Spectra

22

CPC Coding Probability

0.0217289

PhyloCSF Frame 2 

-2.756

CNTI Index

noncoding

Max Probability

0.9896

PhyloCSF Frame 3

-4.712

CNTI Score

-0.349159337