McDonnell Genome Institute

Washington University

Transcript

lnc-RNF123-1:3

Chromosome

chr3

Gene Name

lnc-RNF123-1

Start

49724218

CPC Label

noncoding

End

49725512

Cancer

EOGC

Strand

+

Peptide

LMGIPMLTAQAQR

Modified Peptide

n[145]LMGIPMLTAQAQR

Peptide Length

13

ORF Length

61

Open Reading Frame (ORF)

LMGIPMLTAQAQRGRGGVPGKLLHWSPSSFKHHPSHPTLRGWCQLGPGKHYREGSPEHPNP

Conservation Score

1

PhyloCSF Frame 1

-4.278

No. of Spectra

5

CPC Coding Probability

0.170149

PhyloCSF Frame 2 

-2.408

CNTI Index

noncoding

Max Probability

0.9983

PhyloCSF Frame 3

-0.855

CNTI Score

-0.317310781