McDonnell Genome Institute

Washington University

Transcript

lnc-RNF113B-8:1

Chromosome

chr13

Gene Name

lnc-RNF113B-8

Start

97994372

CPC Label

noncoding

End

97998711

Cancer

OV

Strand

-

Peptide

IFSYTLPFVPSDPLSTPASSMHSK

Modified Peptide

n[145]IFSYTLPFVPSDPLSTPASSMHSK

Peptide Length

24

ORF Length

70

Open Reading Frame (ORF)

MALFPCERIFSYTLPFVPSDPLSTPASSMHSKFTELMKQDLHFIRQNCLGYSRPYVLSEEFQDCSIITLD

Conservation Score

0.55

PhyloCSF Frame 1

-3.545

No. of Spectra

1

CPC Coding Probability

0.127302

PhyloCSF Frame 2 

-5.798

CNTI Index

noncoding

Max Probability

0.5864

PhyloCSF Frame 3

-4.982

CNTI Score

-0.382473533