McDonnell Genome Institute

Washington University

Transcript

lnc-RND3-2:1

Chromosome

chr2

Gene Name

lnc-RND3-2

Start

150595101

CPC Label

noncoding

End

150620067

Cancer

OV

Strand

-

Peptide

LPLLMDSEGGTGIHGERK

Modified Peptide

n[145]LPLLMDSEGGTGIHGERK

Peptide Length

18

ORF Length

82

Open Reading Frame (ORF)

MEHLFQSLDLKIHNSGCTRSMAPACASGEGLRKLPLLMDSEGGTGIHGERKEAKGRERCQTLFNDNSQQLTPHENVTKPFMR

Conservation Score

0.592

PhyloCSF Frame 1

0

No. of Spectra

11

CPC Coding Probability

0.106199

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7213

PhyloCSF Frame 3

0

CNTI Score

-0.409225603