McDonnell Genome Institute

Washington University

Transcript

lnc-RNASET2-1:9

Chromosome

chr6

Gene Name

lnc-RNASET2-1

Start

166977834

CPC Label

noncoding

End

166998086

Cancer

BRCA-Luminal A

Strand

-

Peptide

AGEILSYSGR

Modified Peptide

n[145]AGEILSYSGR

Peptide Length

10

ORF Length

140

Open Reading Frame (ORF)

LRLASLQDEPASWRPRRTDGIVPDQRLAGLKSRKSQCFNLSLKARNKLMSQSKDQKAGEILSYSGRISFFVLFRLLTDWMRLTHMLGRSICFTQAIHLNVNLIPKHPHTHTQDNVSASIWALYGPVKLTHKINHKYVPVT

Conservation Score

0.633

PhyloCSF Frame 1

0

No. of Spectra

6

CPC Coding Probability

0.172171

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9967

PhyloCSF Frame 3

0

CNTI Score

-0.382630563