McDonnell Genome Institute

Washington University

Transcript

lnc-RNASET2-1:8

Chromosome

chr6

Gene Name

lnc-RNASET2-1

Start

166980542

CPC Label

noncoding

End

166999082

Cancer

BRCA-Luminal B

Strand

-

Peptide

SGDILIVGR

Modified Peptide

n[145]SGDILIVGR

Peptide Length

9

ORF Length

86

Open Reading Frame (ORF)

LTLLYHTDSRNVVLYWGDFALPRGHLTRSGDILIVGRGRDTLLQASSWQSPEIPLHTLHCAEQPLRPGIIRPKQNTKLVFNFKVYA

Conservation Score

0.249

PhyloCSF Frame 1

0

No. of Spectra

6

CPC Coding Probability

0.0738332

PhyloCSF Frame 2 

-4.651

CNTI Index

noncoding

Max Probability

0.9991

PhyloCSF Frame 3

0

CNTI Score

-0.317747055