McDonnell Genome Institute

Washington University

Transcript

lnc-RNASEH1-8:1

Chromosome

chr2

Gene Name

lnc-RNASEH1-8

Start

3688020

CPC Label

noncoding

End

3688981

Cancer

CCRC

Strand

-

Peptide

LPPLLMPLMFMWGVNHEK

Modified Peptide

n[43]LPPLLM[147]PLM[147]FMWGVNHEK

Peptide Length

18

ORF Length

129

Open Reading Frame (ORF)

LPPLLMPLMFMWGVNHEKYENNLKILSSASYTTYYLALLAKVIHDNFGTMEGLMTTAYAITTTPKTMGAPSWKRWQDGHRALQNIISASTCTAKAVGKVIPKLNGSSLAWCSISPPLCHFGPDLPSGET

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

110

CPC Coding Probability

0.359517

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9558

PhyloCSF Frame 3

0

CNTI Score

0.658015532