McDonnell Genome Institute

Washington University

Transcript

lnc-RNASEH1-3:1

Chromosome

chr2

Gene Name

lnc-RNASEH1-3

Start

3702584

CPC Label

noncoding

End

3704153

Cancer

OV

Strand

-

Peptide

GEGVFGR

Modified Peptide

n[145]GEGVFGR

Peptide Length

7

ORF Length

200

Open Reading Frame (ORF)

LGRTPGGHGPDHAQTQEGGEGRRARGGRGRTYSSSLKRSRPAATYLPPACSASSPSTRCPRVGVKRRRTPNGTSTCSVSCSSSASKVEFDRFSPSVFQDSWPRVGNLSFSTRGGGVQSHWEAVRNRAIAAGVRCQARAIQNASSLGNDSKGEGVFGRIVPTLGKDRPVPLSDSRQSVGYMLRLEVHTEGTDIDIMSINIL

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.00463078

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7768

PhyloCSF Frame 3

12.68

CNTI Score

-0.285289924