McDonnell Genome Institute

Washington University

Transcript

lnc-RNASE13-1:1

Chromosome

chr14

Gene Name

lnc-RNASE13-1

Start

21042081

CPC Label

noncoding

End

21045938

Cancer

HCC

Strand

-

Peptide

ASQSGNLK

Modified Peptide

n[230]ASQSGNLK

Peptide Length

8

ORF Length

115

Open Reading Frame (ORF)

LGVGEWCGVLERELKVSQRASQSGNLKDSVQVYRNQVELLRVLFLGRLTGHYVRLVLSLLFGLFSLLNSLRAGPGYAVSVWGWAGSITGSGNESGSCLSTYMSQIRGHLRMPVPA

Conservation Score

1

PhyloCSF Frame 1

-4.151

No. of Spectra

3

CPC Coding Probability

0.175481

PhyloCSF Frame 2 

-4.619

CNTI Index

noncoding

Max Probability

0.9999

PhyloCSF Frame 3

4.081

CNTI Score

-0.367957359