McDonnell Genome Institute

Washington University

Transcript

lnc-RNASE1-2:2

Chromosome

chr14

Gene Name

lnc-RNASE1-2

Start

20700553

CPC Label

noncoding

End

20799949

Cancer

EOGC

Strand

-

Peptide

TTTSSAGPAR

Modified Peptide

n[145]TTTSSAGPAR

Peptide Length

10

ORF Length

47

Open Reading Frame (ORF)

LSCGCLRHGFYLKTTTSSAGPARASFAAADAAHTPRGRKRMPPASNL

Conservation Score

0.546

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.158088

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9996

PhyloCSF Frame 3

0

CNTI Score

-0.317789107