McDonnell Genome Institute

Washington University

Transcript

lnc-RNASE1-2:1

Chromosome

chr14

Gene Name

lnc-RNASE1-2

Start

20685345

CPC Label

noncoding

End

20799949

Cancer

OV

Strand

-

Peptide

IILLCLSSVK

Modified Peptide

n[145]IILLCLSSVK

Peptide Length

10

ORF Length

64

Open Reading Frame (ORF)

MSHRAGPTQLLYSILVLSRQSELTLKGPLKVAVRRKPTLTITINSKIILLCLSSVKELLELKRM

Conservation Score

0.873

PhyloCSF Frame 1

0

No. of Spectra

5

CPC Coding Probability

0.0500408

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9552

PhyloCSF Frame 3

0

CNTI Score

-0.354891953