McDonnell Genome Institute

Washington University

Transcript

lnc-RMI1-9:1

Chromosome

chr9

Gene Name

lnc-RMI1-9

Start

83956782

CPC Label

noncoding

End

83957780

Cancer

OV

Strand

+

Peptide

SHLGWVMTK

Modified Peptide

n[145]SHLGWVM[147]TK

Peptide Length

9

ORF Length

43

Open Reading Frame (ORF)

LAVYLSTKSHLGWVMTKAAIVIPLLQVKLSGSLINPHHSNGLG

Conservation Score

0.156

PhyloCSF Frame 1

-4.814

No. of Spectra

24

CPC Coding Probability

0.0389759

PhyloCSF Frame 2 

-4.229

CNTI Index

noncoding

Max Probability

0.932

PhyloCSF Frame 3

-3.442

CNTI Score

-0.336249907