McDonnell Genome Institute

Washington University

Transcript

lnc-RMI1-5:9

Chromosome

chr9

Gene Name

lnc-RMI1-5

Start

83848809

CPC Label

noncoding

End

83859154

Cancer

LUAD

Strand

+

Peptide

MRPDHSQEFSIR

Modified Peptide

n[230]MRPDHSQEFSIR

Peptide Length

12

ORF Length

97

Open Reading Frame (ORF)

LAICLGKMRPDHSQEFSIRVGGELLLTDNDEKPQLRRQIYSRKVIVSKCLAVPGRGHVHGPLCKDISVSSPAWFMVPNKCQVNSLHLTKSQGTKFTR

Conservation Score

1

PhyloCSF Frame 1

-2.683

No. of Spectra

12

CPC Coding Probability

0.169483

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8251

PhyloCSF Frame 3

-3.874

CNTI Score

-0.360901794