McDonnell Genome Institute

Washington University

Transcript

lnc-RMDN3-1:1

Chromosome

chr15

Gene Name

lnc-RMDN3-1

Start

40714012

CPC Label

noncoding

End

40717423

Cancer

OV

Strand

-

Peptide

ISHIMGIHGR

Modified Peptide

n[145]ISHIMGIHGR

Peptide Length

10

ORF Length

52

Open Reading Frame (ORF)

LADKISHIMGIHGRSKGHIYNKRGSCLKKDLEPVAKRTESRICLSFLERRKY

Conservation Score

0.969

PhyloCSF Frame 1

-4.104

No. of Spectra

1

CPC Coding Probability

0.213402

PhyloCSF Frame 2 

-5.409

CNTI Index

noncoding

Max Probability

0.9979

PhyloCSF Frame 3

-5.487

CNTI Score

-0.426152115