McDonnell Genome Institute

Washington University

Transcript

lnc-RMDN2-3:26

Chromosome

chr2

Gene Name

lnc-RMDN2-3

Start

37771129

CPC Label

noncoding

End

37815103

Cancer

EOGC

Strand

+

Peptide

LGQDGALVPK

Modified Peptide

n[145]LGQDGALVPK

Peptide Length

10

ORF Length

43

Open Reading Frame (ORF)

LGQDGALVPKDAGETGNWTLPASVPWAQPSPGTVYSAISTPLL

Conservation Score

0.063

PhyloCSF Frame 1

-3.264

No. of Spectra

10

CPC Coding Probability

0.181669

PhyloCSF Frame 2 

-4.637

CNTI Index

noncoding

Max Probability

0.998

PhyloCSF Frame 3

-4.096

CNTI Score

-0.31950816