McDonnell Genome Institute

Washington University

Transcript

lnc-RMDN2-3:25

Chromosome

chr2

Gene Name

lnc-RMDN2-3

Start

37771129

CPC Label

noncoding

End

37772594

Cancer

OV

Strand

+

Peptide

AGSALLAAR

Modified Peptide

n[145]AGSALLAAR

Peptide Length

9

ORF Length

101

Open Reading Frame (ORF)

LSRSRQPQATGSTCPAVRLLNCSPVCVHVRTHETGATVSSPPRNSAWFMRTNLVGLGSWSDPLPELLLSLSYPTTQASLSVLKLRPSEQKAGSALLAARGH

Conservation Score

0.682

PhyloCSF Frame 1

-4.796

No. of Spectra

2

CPC Coding Probability

0.0267293

PhyloCSF Frame 2 

-4.676

CNTI Index

noncoding

Max Probability

0.7532

PhyloCSF Frame 3

0

CNTI Score

-0.346203727