McDonnell Genome Institute

Washington University

Transcript

lnc-RMDN2-3:15

Chromosome

chr2

Gene Name

lnc-RMDN2-3

Start

37600165

CPC Label

noncoding

End

37614032

Cancer

BRCA-Luminal A

Strand

+

Peptide

ARHNSLVLDTK

Modified Peptide

n[145]ARHNSLVLDTK

Peptide Length

11

ORF Length

42

Open Reading Frame (ORF)

MNCYIWSQFKARHNSLVLDTKEVLQFNYDLGEVRARQVNLAS

Conservation Score

0.931

PhyloCSF Frame 1

-5.009

No. of Spectra

3

CPC Coding Probability

0.0562069

PhyloCSF Frame 2 

-4.286

CNTI Index

noncoding

Max Probability

0.6818

PhyloCSF Frame 3

-4.287

CNTI Score

-0.400980275