McDonnell Genome Institute

Washington University

Transcript

lnc-RMDN2-11:1

Chromosome

chr2

Gene Name

lnc-RMDN2-11

Start

37671767

CPC Label

noncoding

End

37672672

Cancer

LUAD

Strand

+

Peptide

ARGGGSPLDPR

Modified Peptide

n[230]ARGGGSPLDPR

Peptide Length

11

ORF Length

36

Open Reading Frame (ORF)

LARGQPVAGRARGGGSPLDPRRTMGAHCYLPSATPQ

Conservation Score

0.806

PhyloCSF Frame 1

-4.427

No. of Spectra

5

CPC Coding Probability

0.0149103

PhyloCSF Frame 2 

-2.739

CNTI Index

noncoding

Max Probability

0.9809

PhyloCSF Frame 3

-0.235

CNTI Score

-0.292922096