McDonnell Genome Institute

Washington University

Transcript

lnc-RLIM-7:1

Chromosome

chrX

Gene Name

lnc-RLIM-7

Start

74376124

CPC Label

noncoding

End

74376885

Cancer

OSCC

Strand

-

Peptide

ILDIPGLTDTMVPR

Modified Peptide

n[145]ILDIPGLTDTM[147]VPR

Peptide Length

14

ORF Length

81

Open Reading Frame (ORF)

LERERENHFMDASLSVLILVIVKKKKKKKKERRILDIPGLTDTMVPRRLGPKRASRIHKFLNLSKDDVCQVCCKKALKQRM

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

28

CPC Coding Probability

0.246864

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9837

PhyloCSF Frame 3

0

CNTI Score

-0.351266864