McDonnell Genome Institute

Washington University

Transcript

lnc-RLIM-5:1

Chromosome

chrX

Gene Name

lnc-RLIM-5

Start

74473016

CPC Label

noncoding

End

74473953

Cancer

BRCA-HER2-enriched

Strand

-

Peptide

EDTEEHQLR

Modified Peptide

n[145]EDTEEHQLR

Peptide Length

9

ORF Length

106

Open Reading Frame (ORF)

LKQPENGSKWLSHFKQWGMLTDCVVMSDPNTKPSRGFGFVTYDTVGEMDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTLKKIFVGGIKEDTEEHQLRDYFE

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.488863

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.6603

PhyloCSF Frame 3

0

CNTI Score

-0.300738379