McDonnell Genome Institute

Washington University

Transcript

lnc-RLIM-4:1

Chromosome

chrX

Gene Name

lnc-RLIM-4

Start

74583087

CPC Label

coding

End

74583546

Cancer

EOGC

Strand

-

Peptide

LAATAAAATPAVR

Modified Peptide

n[145]LAATAAAATPAVR

Peptide Length

13

ORF Length

146

Open Reading Frame (ORF)

MGPRLAATAAAATPAVRTVPQYKYAAGVCNPQQHLNAQPQVTVQQPAIHVQGQEPLTVSMLASAPQEQKQMLGEWLFPLIQAMHPTLAGKITGVLLEIDNSELLHMLKSPESLHSKVDEAVAVLQAHQAKETAQKAVNSATGVPTV

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.935096

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.1061

PhyloCSF Frame 3

0

CNTI Score

-0.370854373