McDonnell Genome Institute

Washington University

Transcript

lnc-RLIM-1:2

Chromosome

chrX

Gene Name

lnc-RLIM-1

Start

74408535

CPC Label

noncoding

End

74420767

Cancer

HCC

Strand

-

Peptide

SQGALIVEK

Modified Peptide

n[230]SQGALIVEK

Peptide Length

9

ORF Length

46

Open Reading Frame (ORF)

LMTQHHLGFKSQLGWIVRRSQGALIVEKKSKDREGFGFVTCNQEES

Conservation Score

1

PhyloCSF Frame 1

-5.417

No. of Spectra

142

CPC Coding Probability

0.0937031

PhyloCSF Frame 2 

-5.624

CNTI Index

coding

Max Probability

0.9989

PhyloCSF Frame 3

-5.479

CNTI Score

0.670455653