McDonnell Genome Institute

Washington University

Transcript

lnc-RLF-4:1

Chromosome

chr1

Gene Name

lnc-RLF-4

Start

40133032

CPC Label

noncoding

End

40135704

Cancer

OV

Strand

+

Peptide

LPYWTTQPQGLKNELLAR

Modified Peptide

n[145]LPYWTTQPQGLKNELLAR

Peptide Length

18

ORF Length

64

Open Reading Frame (ORF)

LLHGLHVGERVFGRGVVAAAAGLGIKLLGPPRRLPGGCERLPYWTTQPQGLKNELLARHGGVHL

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0163456

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.1329

PhyloCSF Frame 3

0

CNTI Score

-0.295763427