McDonnell Genome Institute

Washington University

Transcript

lnc-RLBP1-3:1

Chromosome

chr15

Gene Name

lnc-RLBP1-3

Start

89201090

CPC Label

noncoding

End

89201768

Cancer

LUAD

Strand

-

Peptide

LSEANQHLRDEGLRLR

Modified Peptide

‚Äč

Peptide Length

16

ORF Length

114

Open Reading Frame (ORF)

MEIPNENDKLNDMEPSKAVPLNASKQDGPTPQPHSASLHDTETRKLTEECKRLQGEMMKLSEANQHLRDEGLRLRKVAYSDKPGSTSTASFRDVTSLLPSLLVVIAAIFTGFLF

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0794772

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.1116

PhyloCSF Frame 3

0

CNTI Score

-0.351822505