McDonnell Genome Institute

Washington University

Transcript

lnc-RIT2-7:1

Chromosome

chr18

Gene Name

lnc-RIT2-7

Start

42259774

CPC Label

noncoding

End

42260222

Cancer

PRAD

Strand

-

Peptide

KSTQESFLFK

Modified Peptide

‚Äč

Peptide Length

10

ORF Length

46

Open Reading Frame (ORF)

LPRTSRSSHLSLPKCWDYRCETPHPALKFLKKSTQESFLFKVWKDM

Conservation Score

0.023

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0151735

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7119

PhyloCSF Frame 3

0

CNTI Score

-0.497036922