McDonnell Genome Institute

Washington University

Transcript

lnc-RIPOR3-9:1

Chromosome

chr20

Gene Name

lnc-RIPOR3-9

Start

50379016

CPC Label

noncoding

End

50379321

Cancer

PRAD

Strand

-

Peptide

FGCSCAILALPCQNGK

Modified Peptide

FGCSCAILALPCQNGK

Peptide Length

16

ORF Length

34

Open Reading Frame (ORF)

LGYECKNAGCFAAAGRFGCSCAILALPCQNGKLL

Conservation Score

1

PhyloCSF Frame 1

-2.945

No. of Spectra

18

CPC Coding Probability

0.0112793

PhyloCSF Frame 2 

-0.211

CNTI Index

noncoding

Max Probability

0.9946

PhyloCSF Frame 3

-3.408

CNTI Score

-0.387123987