McDonnell Genome Institute

Washington University

Transcript

lnc-RIPOR3-1:1

Chromosome

chr20

Gene Name

lnc-RIPOR3-1

Start

50570974

CPC Label

noncoding

End

50578041

Cancer

OV

Strand

-

Peptide

NRSNGLASVSSSAPSLRLLAAVIK

Modified Peptide

n[145]NRSNGLASVSSSAPSLRLLAAVIK

Peptide Length

24

ORF Length

60

Open Reading Frame (ORF)

MSLPWLGLPQRNRSNGLASVSSSAPSLRLLAAVIKRQPSLGGVRNIFNDLRAPSKWEPVT

Conservation Score

0.071

PhyloCSF Frame 1

-2.741

No. of Spectra

4

CPC Coding Probability

0.177987

PhyloCSF Frame 2 

-4.382

CNTI Index

noncoding

Max Probability

0.7614

PhyloCSF Frame 3

-2.511

CNTI Score

-0.293393219