McDonnell Genome Institute

Washington University

Transcript

lnc-RIPOR2-9:1

Chromosome

chr6

Gene Name

lnc-RIPOR2-9

Start

25272199

CPC Label

noncoding

End

25273751

Cancer

BRCA-Luminal B

Strand

-

Peptide

MKGGFLGGR

Modified Peptide

n[145]MKGGFLGGR

Peptide Length

9

ORF Length

33

Open Reading Frame (ORF)

MKGGFLGGRSSGSPYGGDYGSGGKSGGYNNRRF

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.197334

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.0708

PhyloCSF Frame 3

0

CNTI Score

0.695222592