McDonnell Genome Institute

Washington University

Transcript

lnc-RIPOR1-1:7

Chromosome

chr16

Gene Name

lnc-RIPOR1-1

Start

67481403

CPC Label

noncoding

End

67506689

Cancer

OV

Strand

+

Peptide

MPLPSSLGDK

Modified Peptide

n[145]M[147]PLPSSLGDK

Peptide Length

10

ORF Length

50

Open Reading Frame (ORF)

MPLPSSLGDKSETPSQKKKNSWVWWCTPVVPATREAEAGESLEPRRQRLQ

Conservation Score

0.557

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.453778

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.6772

PhyloCSF Frame 3

0

CNTI Score

-0.302321475