McDonnell Genome Institute

Washington University

Transcript

lnc-RIPOR1-1:5

Chromosome

chr16

Gene Name

lnc-RIPOR1-1

Start

67481403

CPC Label

noncoding

End

67497609

Cancer

BRCA-Luminal A

Strand

+

Peptide

VTGWNFCLHGGSSLK

Modified Peptide

n[145]VTGWNFCLHGGSSLK

Peptide Length

15

ORF Length

60

Open Reading Frame (ORF)

MSSFKKCHAGCRFPTSRVTGWNFCLHGGSSLKCLETRSKEFLPPAALLGFLEETVCRWGS

Conservation Score

0.695

PhyloCSF Frame 1

-5.172

No. of Spectra

110

CPC Coding Probability

0.443095

PhyloCSF Frame 2 

-3.614

CNTI Index

noncoding

Max Probability

0.9986

PhyloCSF Frame 3

-4.559

CNTI Score

-0.302321475