McDonnell Genome Institute

Washington University

Transcript

lnc-RIPOR1-1:14

Chromosome

chr16

Gene Name

lnc-RIPOR1-1

Start

67492761

CPC Label

noncoding

End

67504114

Cancer

EOGC

Strand

+

Peptide

VGGELVHGYVSSQMTTEK

Modified Peptide

n[145]VGGELVHGYVSSQM[147]TTEK

Peptide Length

18

ORF Length

118

Open Reading Frame (ORF)

LALGLFLCLFSVQGYATQRVGGELVHGYVSSQMTTEKATMPSRHDSRPSNLLKTLQCWGPRHFCEAVHTLSACEDWAVHLGVWLPLLRAAGRLGLTVIALRPHPQPRSSFSSFSQREP

Conservation Score

0.852

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.0824612

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9992

PhyloCSF Frame 3

0

CNTI Score

-0.348678952