McDonnell Genome Institute

Washington University

Transcript

lnc-RIPK4-2:1

Chromosome

chr21

Gene Name

lnc-RIPK4-2

Start

41716709

CPC Label

noncoding

End

41718989

Cancer

PRAD

Strand

-

Peptide

LGGLNNTHCLMVLK

Modified Peptide

LGGLNNTHCLMVLK

Peptide Length

14

ORF Length

63

Open Reading Frame (ORF)

MNIHRLGGLNNTHCLMVLKIRMLKWVLRGKICEQSFLPSPGPDGGRGSWASVSRAGFFWRLRG

Conservation Score

0.006

PhyloCSF Frame 1

0

No. of Spectra

10

CPC Coding Probability

0.0709216

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9753

PhyloCSF Frame 3

0

CNTI Score

-0.330910637