McDonnell Genome Institute

Washington University

Transcript

lnc-RIOK3-4:1

Chromosome

chr18

Gene Name

lnc-RIOK3-4

Start

23367188

CPC Label

noncoding

End

23367533

Cancer

BRCA-HER2-enriched

Strand

+

Peptide

LDGMSFDR

Modified Peptide

n[145]LDGMSFDR

Peptide Length

8

ORF Length

49

Open Reading Frame (ORF)

LDGMSFDRRGCRGWGTGAPTVGFSSMKVLQRGAGGREGFPERAMGGCQR

Conservation Score

0.453

PhyloCSF Frame 1

-4.098

No. of Spectra

1

CPC Coding Probability

0.0515808

PhyloCSF Frame 2 

-4.959

CNTI Index

noncoding

Max Probability

0.5154

PhyloCSF Frame 3

-4.678

CNTI Score

-0.440603127