McDonnell Genome Institute

Washington University

Transcript

lnc-RIOK2-5:1

Chromosome

chr5

Gene Name

lnc-RIOK2-5

Start

97677546

CPC Label

coding

End

97678681

Cancer

OV

Strand

-

Peptide

TTHQTPFHHSSDK

Modified Peptide

n[145]TTHQTPFHHSSDK

Peptide Length

13

ORF Length

35

Open Reading Frame (ORF)

LNRRTTHQTPFHHSSDKLHSLHIFLLFLFLYQSPA

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

21

CPC Coding Probability

0.700196

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9969

PhyloCSF Frame 3

0

CNTI Score

-0.393143742