McDonnell Genome Institute

Washington University

Transcript

lnc-RIOK1-2:1

Chromosome

chr6

Gene Name

lnc-RIOK1-2

Start

7183082

CPC Label

noncoding

End

7185287

Cancer

BRCA-HER2-enriched

Strand

+

Peptide

QDDFLNK

Modified Peptide

n[145]QDDFLNK

Peptide Length

7

ORF Length

51

Open Reading Frame (ORF)

MQDDFLNKFVSLWLVTWRPFFFFKTCIYILLMYHHPVGNFKNFVYVKLPIY

Conservation Score

0.992

PhyloCSF Frame 1

0

No. of Spectra

6

CPC Coding Probability

0.0203161

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9954

PhyloCSF Frame 3

0

CNTI Score

-0.410458836