McDonnell Genome Institute

Washington University

Transcript

lnc-RINT1-6:1

Chromosome

chr7

Gene Name

lnc-RINT1-6

Start

105647742

CPC Label

noncoding

End

105677369

Cancer

PRAD

Strand

+

Peptide

LMGQVWQTAGPGHGGATDPR

Modified Peptide

LM[147]GQVWQTAGPGHGGATDPR

Peptide Length

20

ORF Length

61

Open Reading Frame (ORF)

LMGQVWQTAGPGHGGATDPRILGRRSMSWDSPYLKYLIEWLGIVAHTCNPGTLGGRGGWTT

Conservation Score

0.059

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.0282859

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9413

PhyloCSF Frame 3

0

CNTI Score

-0.306443191