McDonnell Genome Institute

Washington University

Transcript

lnc-RIMS3-8:1

Chromosome

chr1

Gene Name

lnc-RIMS3-8

Start

40530835

CPC Label

noncoding

End

40531487

Cancer

OV

Strand

-

Peptide

SDENLIGVGGK

Modified Peptide

n[145]SDENLIGVGGK

Peptide Length

11

ORF Length

40

Open Reading Frame (ORF)

MLKRHFGSGGSLIKSDENLIGVGGKDGRRGNGESKYTQYF

Conservation Score

0.281

PhyloCSF Frame 1

-4.307

No. of Spectra

1

CPC Coding Probability

0.0212794

PhyloCSF Frame 2 

-3.873

CNTI Index

noncoding

Max Probability

0.5905

PhyloCSF Frame 3

-5.504

CNTI Score

-0.415420145