McDonnell Genome Institute

Washington University

Transcript

lnc-RIMS3-4:3

Chromosome

chr1

Gene Name

lnc-RIMS3-4

Start

40485374

CPC Label

noncoding

End

40508682

Cancer

CCRC

Strand

-

Peptide

QQQQQQITPMHIR

Modified Peptide

n[230]QQQQQQITPM[147]HIR

Peptide Length

13

ORF Length

44

Open Reading Frame (ORF)

LLEPRRWRLQWAKIMPLHSCLGDRARLRLKKQQQQQQITPMHIR

Conservation Score

0.252

PhyloCSF Frame 1

0

No. of Spectra

36

CPC Coding Probability

0.0294335

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9988

PhyloCSF Frame 3

0

CNTI Score

-0.364926844