McDonnell Genome Institute

Washington University

Transcript

lnc-RIMBP2-7:1

Chromosome

chr12

Gene Name

lnc-RIMBP2-7

Start

130216806

CPC Label

noncoding

End

130217157

Cancer

OV

Strand

-

Peptide

IHPQPTHLHSPPETAK

Modified Peptide

n[145]IHPQPTHLHSPPETAK

Peptide Length

16

ORF Length

48

Open Reading Frame (ORF)

LWRRLLTWASFQRRIHPQPTHLHSPPETAKWIILISVSQELGLKSPLQ

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0296958

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.993

PhyloCSF Frame 3

0

CNTI Score

-0.338472152