McDonnell Genome Institute

Washington University

Transcript

lnc-RICTOR-54:8

Chromosome

chr5

Gene Name

lnc-RICTOR-54

Start

38812108

CPC Label

coding

End

38845762

Cancer

OV

Strand

-

Peptide

DIILFYSCMVFHNMK

Modified Peptide

n[145]DIILFYSCMVFHNMK

Peptide Length

15

ORF Length

42

Open Reading Frame (ORF)

LHWFAKNNGLQLHPCSYRERDIILFYSCMVFHNMKTFTVAHL

Conservation Score

0.486

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.585548

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.7947

PhyloCSF Frame 3

0

CNTI Score

0.705593189