McDonnell Genome Institute

Washington University

Transcript

lnc-RICTOR-54:16

Chromosome

chr5

Gene Name

lnc-RICTOR-54

Start

38710366

CPC Label

noncoding

End

38720273

Cancer

OV

Strand

-

Peptide

EAALQEISMVQAPGK

Modified Peptide

n[145]EAALQEISM[147]VQAPGK

Peptide Length

15

ORF Length

95

Open Reading Frame (ORF)

MSCPGKSQVKEAALQEISMVQAPGKASLTTLARNKRLQKSGQDDFEAVQNSCHSLLQHVFLLYFRHGRGDTAITKGQLLHPEKKKMKIMTSLQLR

Conservation Score

0.996

PhyloCSF Frame 1

-2.722

No. of Spectra

5

CPC Coding Probability

0.20955

PhyloCSF Frame 2 

-3.201

CNTI Index

noncoding

Max Probability

0.9159

PhyloCSF Frame 3

-5.538

CNTI Score

-0.384727995