McDonnell Genome Institute

Washington University

Transcript

lnc-RICTOR-54:11

Chromosome

chr5

Gene Name

lnc-RICTOR-54

Start

38819054

CPC Label

noncoding

End

38845762

Cancer

LUAD

Strand

-

Peptide

AEGAGYR

Modified Peptide

n[230]AEGAGYR

Peptide Length

7

ORF Length

113

Open Reading Frame (ORF)

LAAQRELIPQSSPAGTEPLTTRNPHRPVNATRSPSSRRHLSLHTSPRAEGAGYRLGQPQSGAPTAQRQAEELLKCGQSGRGGRGGAKSQIFIVSGLVFKSSIHFELIFVYGVK

Conservation Score

0.105

PhyloCSF Frame 1

0

No. of Spectra

10

CPC Coding Probability

0.034346

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.998

PhyloCSF Frame 3

0

CNTI Score

-0.294941233