McDonnell Genome Institute

Washington University

Transcript

lnc-RIBC1-6:1

Chromosome

chrX

Gene Name

lnc-RIBC1-6

Start

53825886

CPC Label

coding

End

53826309

Cancer

BRCA-Basal-like

Strand

+

Peptide

QVSSIEDLPTPMENPYK

Modified Peptide

n[145]QVSSIEDLPTPM[147]ENPYK

Peptide Length

17

ORF Length

129

Open Reading Frame (ORF)

LTHLVTAAVSLTHPGTPMVLSRRGYSQYKQVSSIEDLPTPMENPYKESLKKCVLCGKHVNYKNAQLLSQFVSPFTGCIYGRHVTGLCGKKQKEITKAIKRAQIMGFMPVTYKDPAYLKDPKVCNIRYQE

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.834556

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.4737

PhyloCSF Frame 3

0

CNTI Score

-0.425086015