McDonnell Genome Institute

Washington University

Transcript

lnc-RHOXF1-2:1

Chromosome

chrX

Gene Name

lnc-RHOXF1-2

Start

120143509

CPC Label

noncoding

End

120145395

Cancer

OV

Strand

-

Peptide

GLETAPR

Modified Peptide

n[145]GLETAPR

Peptide Length

7

ORF Length

39

Open Reading Frame (ORF)

MRQRSVLPHEKGLETAPRRERIHVRISTKIVRNACFPVP

Conservation Score

0.479

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.216739

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7101

PhyloCSF Frame 3

0

CNTI Score

-0.517013405