McDonnell Genome Institute

Washington University

Transcript

lnc-RHOV-1:1

Chromosome

chr15

Gene Name

lnc-RHOV-1

Start

41023868

CPC Label

noncoding

End

41030216

Cancer

OV

Strand

-

Peptide

KQMVLNCLK

Modified Peptide

n[145]KQM[147]VLNCLK

Peptide Length

9

ORF Length

37

Open Reading Frame (ORF)

LITLNKLIRKQMVLNCLKEKFRRITGLSHCAQPVPSV

Conservation Score

0.765

PhyloCSF Frame 1

-4.572

No. of Spectra

1

CPC Coding Probability

0.10863

PhyloCSF Frame 2 

-4.349

CNTI Index

coding

Max Probability

0.201

PhyloCSF Frame 3

-2.974

CNTI Score

0.672970445