McDonnell Genome Institute

Washington University

Transcript

lnc-RHOU-7:1

Chromosome

chr1

Gene Name

lnc-RHOU-7

Start

228776311

CPC Label

noncoding

End

228776865

Cancer

OV

Strand

+

Peptide

NGFSLLWK

Modified Peptide

n[145]NGFSLLWK

Peptide Length

8

ORF Length

74

Open Reading Frame (ORF)

MGQVVTGTLGADLVVTFSKSKQRPRQLLLKCFAYSKVLPHDSIDFSIRNLSISDVHCRRNGFSLLWKLPTLLHR

Conservation Score

1

PhyloCSF Frame 1

-3.687

No. of Spectra

21

CPC Coding Probability

0.140604

PhyloCSF Frame 2 

-3.527

CNTI Index

noncoding

Max Probability

0.9549

PhyloCSF Frame 3

-5.388

CNTI Score

-0.306996226