McDonnell Genome Institute

Washington University

Transcript

lnc-RHOG-4:1

Chromosome

chr11

Gene Name

lnc-RHOG-4

Start

3972880

CPC Label

coding

End

3974237

Cancer

BRCA-Luminal A

Strand

-

Peptide

EMASVSSSQRGR

Modified Peptide

n[145]EM[147]ASVSSSQRGR

Peptide Length

12

ORF Length

148

Open Reading Frame (ORF)

LSNREHSQTVVMRDPNTKCSRGFGFVTYATVEEVDAAVNARLHKVDRRAVSREDSQRPHAHLTMKRIFVGGFKKEKYHTVNGHNYEVRDALSKKEMASVSSSQRGRNGSGNSGDGRGGGFGGNDNFGHGGETSVVVVTLVAAMLVVIW

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

29

CPC Coding Probability

0.888577

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9948

PhyloCSF Frame 3

0

CNTI Score

0.643286999