McDonnell Genome Institute

Washington University

Transcript

lnc-RHOG-1:1

Chromosome

chr11

Gene Name

lnc-RHOG-1

Start

3816751

CPC Label

noncoding

End

3821900

Cancer

HCC

Strand

-

Peptide

SWLLSGQLTK

Modified Peptide

SWLLSGQLTK

Peptide Length

10

ORF Length

70

Open Reading Frame (ORF)

LRPRTMPGSNTRTKASCHLTASGSKSWLLSGQLTKDRWLRMAKALPLTLSDHIPVPYPSSTRNRGSAPEP

Conservation Score

1

PhyloCSF Frame 1

-3.584

No. of Spectra

22

CPC Coding Probability

0.0541057

PhyloCSF Frame 2 

-4.657

CNTI Index

noncoding

Max Probability

0.9975

PhyloCSF Frame 3

-3.203

CNTI Score

-0.303478873