McDonnell Genome Institute

Washington University

Transcript

lnc-RHOC-1:1

Chromosome

chr1

Gene Name

lnc-RHOC-1

Start

112693687

CPC Label

noncoding

End

112696621

Cancer

OV

Strand

-

Peptide

LDSQRLAVEGVR

Modified Peptide

n[145]LDSQRLAVEGVR

Peptide Length

12

ORF Length

62

Open Reading Frame (ORF)

LDSQRLAVEGVRGRGRRQILRSCPEMPSPGTRSLQCSCPLGQLSSCSAYKNPVHQLIGLLKK

Conservation Score

1

PhyloCSF Frame 1

-5.764

No. of Spectra

6

CPC Coding Probability

0.0706751

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9756

PhyloCSF Frame 3

13.466

CNTI Score

-0.316431217