McDonnell Genome Institute

Washington University

Transcript

lnc-RHOBTB2-4:1

Chromosome

chr8

Gene Name

lnc-RHOBTB2-4

Start

22933928

CPC Label

noncoding

End

22943967

Cancer

HCC

Strand

+

Peptide

ISNSSLGQGVFSLLCLLSR

Modified Peptide

n[230]ISNSSLGQGVFSLLCLLSR

Peptide Length

19

ORF Length

100

Open Reading Frame (ORF)

LPALASQSAGIIGVSHHGQPLPRISNSSLGQGVFSLLCLLSRSKFLPHTNREEEPLSLVQNSVGAVGCWLWEGTHLDRFLAWRTRGESSLQGAPQFGPLR

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.098566

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8432

PhyloCSF Frame 3

0

CNTI Score

-0.38287531